(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCE

CP000438.MDCE        Location/Qualifiers
FT   CDS             231082..231888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /locus_tag="PA14_02590"
FT                   /product="malonate decarboxylase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02590"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15161"
FT                   /db_xref="GOA:A0A0H2ZKL8"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKL8"
FT                   /protein_id="ABJ15161.1"
FT                   /translation="MSQPFTSRGLAWFQALAGSLAPRPGDPASLRVADAELDGYPVRFL
FT                   AVVPDPDNPFPRARQGEVGLLEGWGLAAAVDEALEADREAPRKRALLAIVDVPSQAYGR
FT                   REEALGIHQALAGAVDAYARARLAGHPLIGLLVGKAMSGAFLAHGYQANRLIALHDPGV
FT                   MVHAMGKAAAARITLRSVEELEALAAKVPPMAYDIDSYASLGLLWRTLPVETVEVPSTA
FT                   DLVRVRTCLGEALADILGGPRDLGGRLGAANREASAQVRRLLREQW"
     MSQPFTSRGL AWFQALAGSL APRPGDPASL RVADAELDGY PVRFLAVVPD PDNPFPRARQ        60
     GEVGLLEGWG LAAAVDEALE ADREAPRKRA LLAIVDVPSQ AYGRREEALG IHQALAGAVD       120
     AYARARLAGH PLIGLLVGKA MSGAFLAHGY QANRLIALHD PGVMVHAMGK AAAARITLRS       180
     VEELEALAAK VPPMAYDIDS YASLGLLWRT LPVETVEVPS TADLVRVRTC LGEALADILG       240
     GPRDLGGRLG AANREASAQV RRLLREQW                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page