(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCH

CP000438.MDCH        Location/Qualifiers
FT   CDS             232593..233525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcH"
FT                   /locus_tag="PA14_02620"
FT                   /product="putative epsilon subunit of malonate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02620"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15163"
FT                   /db_xref="GOA:A0A0H2ZJE9"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR017554"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJE9"
FT                   /protein_id="ABJ15163.1"
FT                   /translation="MSVLFAYPGQGAQRPGMLAALPDEPPVRACLEQAADCLGQAPAEL
FT                   ESAEALRGTRAVQLCLLIAGVAASRLLETRGHRPGLVAGLSIGAYPAAVVAGALDFDDA
FT                   LRLVALRGELMQAAWPEGYGMSAILGLDQAQLDALILMVRREHPPLYLANVNAERQLVV
FT                   AGSEAALAALAERARAAGASAAKRLAVSVPSHCALLDEPAARLAEAFAGVRLRRPRVPY
FT                   LSSSRARLVAEPAALADDLAGNMARRVEWLATLRSAYERGARLHLELPPGRVLSGLARP
FT                   LFGCATPAFEGSRADTLDALLREEEKRTR"
     MSVLFAYPGQ GAQRPGMLAA LPDEPPVRAC LEQAADCLGQ APAELESAEA LRGTRAVQLC        60
     LLIAGVAASR LLETRGHRPG LVAGLSIGAY PAAVVAGALD FDDALRLVAL RGELMQAAWP       120
     EGYGMSAILG LDQAQLDALI LMVRREHPPL YLANVNAERQ LVVAGSEAAL AALAERARAA       180
     GASAAKRLAV SVPSHCALLD EPAARLAEAF AGVRLRRPRV PYLSSSRARL VAEPAALADD       240
     LAGNMARRVE WLATLRSAYE RGARLHLELP PGRVLSGLAR PLFGCATPAF EGSRADTLDA       300
     LLREEEKRTR                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page