(data stored in ACNUC7421 zone)

EMBL: CP000438.MDCL

CP000438.MDCL        Location/Qualifiers
FT   CDS             233582..233986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcL"
FT                   /locus_tag="PA14_02630"
FT                   /product="putative malonate carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02630"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15164"
FT                   /db_xref="GOA:A0A0H2ZKE5"
FT                   /db_xref="InterPro:IPR004690"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE5"
FT                   /protein_id="ABJ15164.1"
FT                   /translation="MIIYGVALLSLCTLAGLFIGEILGVLLGVPANVGGVGIAMLLLIF
FT                   VGGYLGKRGLLSAKTEQGVEFWSAVYIPIVVAMAAQQNVLGALSGGPAAILAGIAAVAV
FT                   AFALVPLLDRFGRKKAEGAPPLKPRTSVQG"
     MIIYGVALLS LCTLAGLFIG EILGVLLGVP ANVGGVGIAM LLLIFVGGYL GKRGLLSAKT        60
     EQGVEFWSAV YIPIVVAMAA QQNVLGALSG GPAAILAGIA AVAVAFALVP LLDRFGRKKA       120
     EGAPPLKPRT SVQG                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page