(data stored in ACNUC7421 zone)

EMBL: CP000438.METW

CP000438.METW        Location/Qualifiers
FT   CDS             complement(444738..445358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="PA14_05070"
FT                   /product="putative methionine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05070"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15355"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL16"
FT                   /protein_id="ABJ15355.1"
FT                   /translation="MRADLEIIQEWIPAGSRVLDLGCGDGELLAWLRDHKQVSGYGLEI
FT                   DPDNIARCIENGVNVIEQDLDKGLGNFASDSFDVVVMTQALQAVHYPDKILEEMLRVGK
FT                   TCIITFPNFGHWRCRWYLARNGRMPVSEFLPYTWYNTPNIHFCTFQDFERLCRQLRMRV
FT                   LDRLAVDRDHRHGWASRLWPNLLGEIGIYRVTGPGVQTRNLAV"
     MRADLEIIQE WIPAGSRVLD LGCGDGELLA WLRDHKQVSG YGLEIDPDNI ARCIENGVNV        60
     IEQDLDKGLG NFASDSFDVV VMTQALQAVH YPDKILEEML RVGKTCIITF PNFGHWRCRW       120
     YLARNGRMPV SEFLPYTWYN TPNIHFCTFQ DFERLCRQLR MRVLDRLAVD RDHRHGWASR       180
     LWPNLLGEIG IYRVTGPGVQ TRNLAV                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page