(data stored in ACNUC7421 zone)

EMBL: CP000438.MEXA

CP000438.MEXA        Location/Qualifiers
FT   CDS             486775..487926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexA"
FT                   /gene_synonym="arpA"
FT                   /locus_tag="PA14_05530"
FT                   /product="RND multidrug efflux membrane fusion protein MexA
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05530"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15392"
FT                   /db_xref="GOA:A0A0H2ZKX6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKX6"
FT                   /protein_id="ABJ15392.1"
FT                   /translation="MQRTPAMRVLVPALLVAISALSGCGKSEAPPPAQTPEVGIVTLEA
FT                   QTVTLNTELPGRTNAFRIAEVRPQVNGIILKRLFKEGSDVKAGQQLYQIDPATYEADYQ
FT                   SAQANLASTQEQAQRYKLLVADQAVSKQQYADANAAYLQSKAAVEQARINLRYTKVLSP
FT                   ISGRIGRSAVTEGALVTNGQANAMATVQQLDPIYVDVTQPSTALLRLRRELASGQLERA
FT                   GDNAAKVSLKLEDGSQYPLEGRLEFSEVSVDEGTGSVTIRAVFPNPNNELLPGMFVHAQ
FT                   LQEGVKQKAILAPQQGVTRDLKGQATALVVNAQNKVELRVIKADRVIGDKWLVTEGLNA
FT                   GDKIITEGLQFVQPGVEVKTVPAKNVASAQKADAAPAKTDSKG"
     MQRTPAMRVL VPALLVAISA LSGCGKSEAP PPAQTPEVGI VTLEAQTVTL NTELPGRTNA        60
     FRIAEVRPQV NGIILKRLFK EGSDVKAGQQ LYQIDPATYE ADYQSAQANL ASTQEQAQRY       120
     KLLVADQAVS KQQYADANAA YLQSKAAVEQ ARINLRYTKV LSPISGRIGR SAVTEGALVT       180
     NGQANAMATV QQLDPIYVDV TQPSTALLRL RRELASGQLE RAGDNAAKVS LKLEDGSQYP       240
     LEGRLEFSEV SVDEGTGSVT IRAVFPNPNN ELLPGMFVHA QLQEGVKQKA ILAPQQGVTR       300
     DLKGQATALV VNAQNKVELR VIKADRVIGD KWLVTEGLNA GDKIITEGLQ FVQPGVEVKT       360
     VPAKNVASAQ KADAAPAKTD SKG                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page