(data stored in ACNUC7421 zone)

EMBL: CP000438.MICA

CP000438.MICA        Location/Qualifiers
FT   CDS             439406..440077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="micA"
FT                   /gene_synonym="yggH"
FT                   /locus_tag="PA14_05000"
FT                   /product="DNA mismatch repair protein MicA"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05000"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15348"
FT                   /db_xref="GOA:Q02U31"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02U31"
FT                   /protein_id="ABJ15348.1"
FT                   /translation="MRTVKSFVMRAGRMTEGQQRGLDLGWPKFGLELSDEVQDFDAIFG
FT                   RQAPRTFEIGFGMGHSTLEMAAAAPDIDFIGVEVHKPGVGALLNGLLTQGLGNVRVYSC
FT                   DALEVLRHCVADASLDRLLLFFPDPWHKKRHHKRRIVQPEFAELVRRKLKVGGVLHMAT
FT                   DWEPYAEHMLDVMSAAPGYRNQAEDGRFVARPQERPVTKFERRGERLGHGVWDLKFERI
FT                   D"
     MRTVKSFVMR AGRMTEGQQR GLDLGWPKFG LELSDEVQDF DAIFGRQAPR TFEIGFGMGH        60
     STLEMAAAAP DIDFIGVEVH KPGVGALLNG LLTQGLGNVR VYSCDALEVL RHCVADASLD       120
     RLLLFFPDPW HKKRHHKRRI VQPEFAELVR RKLKVGGVLH MATDWEPYAE HMLDVMSAAP       180
     GYRNQAEDGR FVARPQERPV TKFERRGERL GHGVWDLKFE RID                         223
//

If you have problems or comments...

PBIL Back to PBIL home page