(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRF

CP000438.NIRF        Location/Qualifiers
FT   CDS             complement(586475..587653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirF"
FT                   /locus_tag="PA14_06720"
FT                   /product="heme d1 biosynthesis protein NirF"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06720"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15478"
FT                   /db_xref="InterPro:IPR003143"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ6"
FT                   /protein_id="ABJ15478.1"
FT                   /translation="MNLRPLAPLFLALLAGCSQQPPLRGSGDLGVLIERADGSVQILDG
FT                   TAKTSLARVEGLGDLSHASLVFSRDQRYAYVFGRDGGLTKLDLLAQRIDKRLIQGGNSI
FT                   GGAISQDGRLVAVSNYEPGGVKVFDSRTLELVAEIPATRLPGQDRNSRVVGLVDAPGQR
FT                   FVFSLFDSGEIWIADFSQGDTPHLTRFRDIGKQPYDALISPDGRYYMAGLFGEDGMAQL
FT                   DLWHPERGVRRVLGDYGRGQRKLPVYKMPHLEGWTIASDQAFVPAVGHHQVLVLDARDW
FT                   KQTDAIDVAGQPVFVMTRPDDRQIWVNFAYPDNDKVQVIDSETHEVIETLRPGPGVLHM
FT                   EFSGRGDQVWISVRDADQLQVWDPYRLKRIGSLPARSPSGIFFSHRAQHIGL"
     MNLRPLAPLF LALLAGCSQQ PPLRGSGDLG VLIERADGSV QILDGTAKTS LARVEGLGDL        60
     SHASLVFSRD QRYAYVFGRD GGLTKLDLLA QRIDKRLIQG GNSIGGAISQ DGRLVAVSNY       120
     EPGGVKVFDS RTLELVAEIP ATRLPGQDRN SRVVGLVDAP GQRFVFSLFD SGEIWIADFS       180
     QGDTPHLTRF RDIGKQPYDA LISPDGRYYM AGLFGEDGMA QLDLWHPERG VRRVLGDYGR       240
     GQRKLPVYKM PHLEGWTIAS DQAFVPAVGH HQVLVLDARD WKQTDAIDVA GQPVFVMTRP       300
     DDRQIWVNFA YPDNDKVQVI DSETHEVIET LRPGPGVLHM EFSGRGDQVW ISVRDADQLQ       360
     VWDPYRLKRI GSLPARSPSG IFFSHRAQHI GL                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page