(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRG

CP000438.NIRG        Location/Qualifiers
FT   CDS             complement(585057..585500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirG"
FT                   /locus_tag="PA14_06690"
FT                   /product="heme d1 biosynthesis protein NirG"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06690"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15475"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE0"
FT                   /protein_id="ABJ15475.1"
FT                   /translation="MDEFDRRLLNRLQHGLPLEPHPYALLAAELDCREEDILRRLDDLL
FT                   DDGTLTRFGPLFDIEPLGGAFTLAAMSVPEARFEEIAALLAGWPQVAHNYRREHALNMW
FT                   LVVACDSPAEVAETLARLERESGLAVLDLPKEATYHVGLHFPL"
     MDEFDRRLLN RLQHGLPLEP HPYALLAAEL DCREEDILRR LDDLLDDGTL TRFGPLFDIE        60
     PLGGAFTLAA MSVPEARFEE IAALLAGWPQ VAHNYRREHA LNMWLVVACD SPAEVAETLA       120
     RLERESGLAV LDLPKEATYH VGLHFPL                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page