(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRH

CP000438.NIRH        Location/Qualifiers
FT   CDS             complement(584567..585082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirH"
FT                   /locus_tag="PA14_06680"
FT                   /product="heme d1 biosynthesis protein NirH"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06680"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15474"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKR1"
FT                   /protein_id="ABJ15474.1"
FT                   /translation="MSACISPSDALLARRLIELTQAGLPLVADPWAWIAAQLRLSEAET
FT                   LALLKRLRDAGVIRRIAAVPNHYRLGYRHNGMTVWDVADERIERLGRLVGGLSFVSHCY
FT                   RRPRHLPQWRYNLFAMVHGRSEAEIEGYRQQIRLLLGEDCRADEMLVSSRILKKTGLRL
FT                   AQKEERPC"
     MSACISPSDA LLARRLIELT QAGLPLVADP WAWIAAQLRL SEAETLALLK RLRDAGVIRR        60
     IAAVPNHYRL GYRHNGMTVW DVADERIERL GRLVGGLSFV SHCYRRPRHL PQWRYNLFAM       120
     VHGRSEAEIE GYRQQIRLLL GEDCRADEML VSSRILKKTG LRLAQKEERP C                171
//

If you have problems or comments...

PBIL Back to PBIL home page