(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRJ

CP000438.NIRJ        Location/Qualifiers
FT   CDS             complement(583410..584573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirJ"
FT                   /locus_tag="PA14_06670"
FT                   /product="heme d1 biosynthesis protein NirJ"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06670"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15473"
FT                   /db_xref="GOA:A0A0H2ZLJ1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023992"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLJ1"
FT                   /protein_id="ABJ15473.1"
FT                   /translation="MLRISHYLRSLAEDAPAPRRAGGRRAPVVIWNLLRRCNLTCKHCY
FT                   STSADSDFRGELETAEILRGIDDLRAAGVRVLILSGGEPLMHPDLFEIAAHARQAGMFV
FT                   ALSSNGTLIDEGNIQRVAEARFDYVGISLDGLRETHDRFRQKQGSFDAALAAMRLCREA
FT                   DIRVGMRTTLTEENAAQLPALLDLMRELDVQKFYLSHLNYSGRGRRSRALDAHHRRTRE
FT                   ALALLFERADEDIRQGRDSDFVTGNNDADAILLLDWLKRRRPQQLARLCELLLDWGGNA
FT                   SGEGIANIDNTGEVHPDSYWWHHSVGNIRHQRFADFWFERPDPLLLQLRQRPRPVVGRC
FT                   SQCRWLDICNGNTRTRAWAGGELWGEDPGCYLSDQEIGLERIALHAV"
     MLRISHYLRS LAEDAPAPRR AGGRRAPVVI WNLLRRCNLT CKHCYSTSAD SDFRGELETA        60
     EILRGIDDLR AAGVRVLILS GGEPLMHPDL FEIAAHARQA GMFVALSSNG TLIDEGNIQR       120
     VAEARFDYVG ISLDGLRETH DRFRQKQGSF DAALAAMRLC READIRVGMR TTLTEENAAQ       180
     LPALLDLMRE LDVQKFYLSH LNYSGRGRRS RALDAHHRRT REALALLFER ADEDIRQGRD       240
     SDFVTGNNDA DAILLLDWLK RRRPQQLARL CELLLDWGGN ASGEGIANID NTGEVHPDSY       300
     WWHHSVGNIR HQRFADFWFE RPDPLLLQLR QRPRPVVGRC SQCRWLDICN GNTRTRAWAG       360
     GELWGEDPGC YLSDQEIGLE RIALHAV                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page