(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRL

CP000438.NIRL        Location/Qualifiers
FT   CDS             complement(585493..586017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirL"
FT                   /locus_tag="PA14_06700"
FT                   /product="heme d1 biosynthesis protein NirL"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06700"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15476"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLD1"
FT                   /protein_id="ABJ15476.1"
FT                   /translation="MNPVEPLAAPQRQHLRYLLEQGLPLASRPYRVLAERIGAGEDEVL
FT                   EQVRRWDEDGLFRRFGVILHHRALGYTANAMLVLDVADAEVDVVGRALAHETIVSLCYR
FT                   RPRRLPMWPYNLFCMIHGRERGEVERQIEALLERHALRQTPHRWLFSLRAYKQCGGRYT
FT                   APPADLERRHG"
     MNPVEPLAAP QRQHLRYLLE QGLPLASRPY RVLAERIGAG EDEVLEQVRR WDEDGLFRRF        60
     GVILHHRALG YTANAMLVLD VADAEVDVVG RALAHETIVS LCYRRPRRLP MWPYNLFCMI       120
     HGRERGEVER QIEALLERHA LRQTPHRWLF SLRAYKQCGG RYTAPPADLE RRHG             174
//

If you have problems or comments...

PBIL Back to PBIL home page