(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRO

CP000438.NIRO        Location/Qualifiers
FT   CDS             591110..591637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirO"
FT                   /locus_tag="PA14_06790"
FT                   /product="cytochrome c oxidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06790"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15483"
FT                   /db_xref="GOA:A0A0H2ZLK1"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLK1"
FT                   /protein_id="ABJ15483.1"
FT                   /translation="MWFFILAELSVFSLLLLAFAGAQAWQPELFRAGREQLDSRWGLLL
FT                   TVALLSSGWLAALAVHAVRRGRPRQASGWLLAALLLALVYVGLKLHEYGRLADLGLDIE
FT                   HDTFFTLYWCLTGFHFLHVLLGLLILGWLAQACWRRCYTPQACSGLESGVLYWHMVDLV
FT                   WVLLFPLVYVLQ"
     MWFFILAELS VFSLLLLAFA GAQAWQPELF RAGREQLDSR WGLLLTVALL SSGWLAALAV        60
     HAVRRGRPRQ ASGWLLAALL LALVYVGLKL HEYGRLADLG LDIEHDTFFT LYWCLTGFHF       120
     LHVLLGLLIL GWLAQACWRR CYTPQACSGL ESGVLYWHMV DLVWVLLFPL VYVLQ            175
//

If you have problems or comments...

PBIL Back to PBIL home page