(data stored in ACNUC7421 zone)

EMBL: CP000438.NIRQ

CP000438.NIRQ        Location/Qualifiers
FT   CDS             590293..591075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nirQ"
FT                   /locus_tag="PA14_06770"
FT                   /product="regulatory protein NirQ"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15482"
FT                   /db_xref="GOA:A0A0H2ZL51"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL51"
FT                   /protein_id="ABJ15482.1"
FT                   /translation="MRDATPFYEATGHEIEVFERAWRHGLPVLLKGPTGCGKTRFVQYM
FT                   ARRLELPLYSVACHDDLGAADLLGRHLIGADGTWWQDGPLTRAVREGGICYLDEVVEAR
FT                   QDTTVAIHPLADDRRELYLERTGETLQAPPSFMLVVSYNPGYQNLLKGLKPSTRQRFVA
FT                   LRFDYPAAQHEARILVGESGCAEALAQRLVQLGQALRRLEQHDLEEVASTRLLIFAARL
FT                   IGDGMDPREACRVALAEPLSDDPATVAALMDIVDLHVA"
     MRDATPFYEA TGHEIEVFER AWRHGLPVLL KGPTGCGKTR FVQYMARRLE LPLYSVACHD        60
     DLGAADLLGR HLIGADGTWW QDGPLTRAVR EGGICYLDEV VEARQDTTVA IHPLADDRRE       120
     LYLERTGETL QAPPSFMLVV SYNPGYQNLL KGLKPSTRQR FVALRFDYPA AQHEARILVG       180
     ESGCAEALAQ RLVQLGQALR RLEQHDLEEV ASTRLLIFAA RLIGDGMDPR EACRVALAEP       240
     LSDDPATVAA LMDIVDLHVA                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page