(data stored in ACNUC7421 zone)

EMBL: CP000438.NORB

CP000438.NORB        Location/Qualifiers
FT   CDS             592432..593829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="PA14_06830"
FT                   /product="nitric-oxide reductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06830"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15486"
FT                   /db_xref="GOA:A0A0H2ZLE2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZLE2"
FT                   /protein_id="ABJ15486.1"
FT                   /translation="MMSPNGSLKFASQAVAKPYFVFALILFVGQILFGLIMGLQYVVGD
FT                   FLFPAIPFNVARMVHTNLLIVWLLFGFMGAAYYLVPEESDCELYSPKLAWILFWVFAAA
FT                   GVLTILGYLLVPYAGLARLTGNELWPTMGREFLEQPTISKAGIVIVALGFLFNVGMTVL
FT                   RGRKTAISMVLMTGLIGLALLFLFSFYNPENLTRDKFYWWWVVHLWVEGVWELIMGAIL
FT                   AFVLVKVTGVDREVIEKWLYVIIAMALISGIIGTGHHYFWIGVPGYWLWLGSVFSALEP
FT                   LPFFAMVLFAFNTINRRRRDYPNRAVALWAMGTTVMAFLGAGVWGFMHTLAPVNYYTHG
FT                   TQLTAAHGHMAFYGAYAMIVMTIISYAMPRLRGIGEAMDNRSQVLEMWGFWLMTVAMVF
FT                   ITLFLSAAGVLQVWLQRMPADGAAMTFMATQDQLAIFYWLREGAGVVFLIGLVAYLLSF
FT                   RRGKAAA"
     MMSPNGSLKF ASQAVAKPYF VFALILFVGQ ILFGLIMGLQ YVVGDFLFPA IPFNVARMVH        60
     TNLLIVWLLF GFMGAAYYLV PEESDCELYS PKLAWILFWV FAAAGVLTIL GYLLVPYAGL       120
     ARLTGNELWP TMGREFLEQP TISKAGIVIV ALGFLFNVGM TVLRGRKTAI SMVLMTGLIG       180
     LALLFLFSFY NPENLTRDKF YWWWVVHLWV EGVWELIMGA ILAFVLVKVT GVDREVIEKW       240
     LYVIIAMALI SGIIGTGHHY FWIGVPGYWL WLGSVFSALE PLPFFAMVLF AFNTINRRRR       300
     DYPNRAVALW AMGTTVMAFL GAGVWGFMHT LAPVNYYTHG TQLTAAHGHM AFYGAYAMIV       360
     MTIISYAMPR LRGIGEAMDN RSQVLEMWGF WLMTVAMVFI TLFLSAAGVL QVWLQRMPAD       420
     GAAMTFMATQ DQLAIFYWLR EGAGVVFLIG LVAYLLSFRR GKAAA                       465
//

If you have problems or comments...

PBIL Back to PBIL home page