(data stored in ACNUC7421 zone)

EMBL: CP000438.NORC

CP000438.NORC        Location/Qualifiers
FT   CDS             591992..592432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norC"
FT                   /locus_tag="PA14_06810"
FT                   /product="nitric-oxide reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06810"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15485"
FT                   /db_xref="GOA:A0A0H2ZKE8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKE8"
FT                   /protein_id="ABJ15485.1"
FT                   /translation="MSETFTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAM
FT                   SAAVVRGKLVWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMKIQPL
FT                   NVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG"
     MSETFTKGMA RNIYFGGSVF FILLFLALTY HTEKTLPERT NEAAMSAAVV RGKLVWEQNN        60
     CVGCHTLLGE GAYFAPELGN VVGRRGGEEG FNTFLQAWMK IQPLNVPGRR AMPQFHLSEG       120
     QVDDLAEFLK WSSKIDTNQW PPNKEG                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page