(data stored in ACNUC7421 zone)

EMBL: CP000438.NORD

CP000438.NORD        Location/Qualifiers
FT   CDS             593831..595669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norD"
FT                   /locus_tag="PA14_06840"
FT                   /product="putative dinitrification protein NorD"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_06840"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15487"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZL56"
FT                   /protein_id="ABJ15487.1"
FT                   /translation="MAFAVELEEWVGAHWHRFITRHASGEFEAARVTLESMRRPLGMLF
FT                   RALGGAPGVALEATPARRLLLRRTWLQRVAGTCEQAPVSWFNGDSLRLPESLAVYPQAE
FT                   LNRELYRWLALLAASAGPLRHWAQDNQRWARQLLDAYPALRPRYARLVAAHLRQRPSLD
FT                   DCPAADAELEIALRRALAEPGSVERFPRVERAPWPVPLWLYPGERWTPSASAEDGEEAA
FT                   AGAGKRQVARSGARKRAERVEERESERNLLLFRLESLLSWSEHLALDRCSDDEDDPDGA
FT                   RVAEDLDYLSLSRQRTQKGGGLRLDLDLPAADYDDLPLGPGLKLPEWDYRQQRLLSDHV
FT                   LLQPMRPRGATSASLPAHLEKTALHLRRQFACLRDGRQRLRQQPQGDEIDLDAWLDFQV
FT                   ERRRGGSTQPGLFLEQRPRRRDLACLLLADLSMSTEAYLDDQRRVIDSIVDSLLLFGEA
FT                   LQALGDPFALYGFSSVRRQQVRWQVLKDFDEGYGGEVRGRVLALSPGYYTRMGAAIRRA
FT                   SQELGGQPQKRRLLLLLSDGKPNDLDRYEGRYGIEDTRQAVIEARSQGLVPFCITIDKE
FT                   AADYLPYLFGADGFALVERAGQLPERLLQLYRRLRR"
     MAFAVELEEW VGAHWHRFIT RHASGEFEAA RVTLESMRRP LGMLFRALGG APGVALEATP        60
     ARRLLLRRTW LQRVAGTCEQ APVSWFNGDS LRLPESLAVY PQAELNRELY RWLALLAASA       120
     GPLRHWAQDN QRWARQLLDA YPALRPRYAR LVAAHLRQRP SLDDCPAADA ELEIALRRAL       180
     AEPGSVERFP RVERAPWPVP LWLYPGERWT PSASAEDGEE AAAGAGKRQV ARSGARKRAE       240
     RVEERESERN LLLFRLESLL SWSEHLALDR CSDDEDDPDG ARVAEDLDYL SLSRQRTQKG       300
     GGLRLDLDLP AADYDDLPLG PGLKLPEWDY RQQRLLSDHV LLQPMRPRGA TSASLPAHLE       360
     KTALHLRRQF ACLRDGRQRL RQQPQGDEID LDAWLDFQVE RRRGGSTQPG LFLEQRPRRR       420
     DLACLLLADL SMSTEAYLDD QRRVIDSIVD SLLLFGEALQ ALGDPFALYG FSSVRRQQVR       480
     WQVLKDFDEG YGGEVRGRVL ALSPGYYTRM GAAIRRASQE LGGQPQKRRL LLLLSDGKPN       540
     DLDRYEGRYG IEDTRQAVIE ARSQGLVPFC ITIDKEAADY LPYLFGADGF ALVERAGQLP       600
     ERLLQLYRRL RR                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page