(data stored in ACNUC7421 zone)

EMBL: CP000438.OPRM

CP000438.OPRM        Location/Qualifiers
FT   CDS             491084..492541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprM"
FT                   /locus_tag="PA14_05550"
FT                   /product="major intrinsic multiple antibiotic resistance
FT                   efflux outer membrane protein OprM precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_05550"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15394"
FT                   /db_xref="GOA:A0A0H2ZKJ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKJ8"
FT                   /protein_id="ABJ15394.1"
FT                   /translation="MKRSFLSLAVAAVVLSGCSLIPDYQRPEAPVAAAYPQGQAYGQNT
FT                   GAAAVPAADIGWREFFRDPQLQQLIGVALENNRDLRVAALNVEAFRAQYRIQRADLFPR
FT                   IGVDGSGTRQRLPGDLSTTGSPAISSQYGVTLGTTAWELDLFGRLRSLRDQALEQYLAT
FT                   EQAQRSAQTTLVASVATAYLTLKADQAQLQLTKDTLGTYQKSFDLTQRSYDVGVASALD
FT                   LRQAQTAVEGARATLAQYTRLVAQDQNALVLLLGSGIPANLPQGLGLDQTLLTEVPAGL
FT                   PSDLLQRRPDILEAEHQLMAANASIGAARAAFFPSISLTANAGTMSRQLSGLFDAGSGS
FT                   WLFQPSINLPIFTAGSLRASLDYAKIQKDINVAQYEKAIQTAFQEVADGLAARGTFTEQ
FT                   LQAQRDLVKASDEYYQLADKRYRTGVDNYLTLLDAQRSLFTAQQQLITDRLNQLTSEVN
FT                   LYKALGGGWNQQTVTQQQTAKKEDPQA"
     MKRSFLSLAV AAVVLSGCSL IPDYQRPEAP VAAAYPQGQA YGQNTGAAAV PAADIGWREF        60
     FRDPQLQQLI GVALENNRDL RVAALNVEAF RAQYRIQRAD LFPRIGVDGS GTRQRLPGDL       120
     STTGSPAISS QYGVTLGTTA WELDLFGRLR SLRDQALEQY LATEQAQRSA QTTLVASVAT       180
     AYLTLKADQA QLQLTKDTLG TYQKSFDLTQ RSYDVGVASA LDLRQAQTAV EGARATLAQY       240
     TRLVAQDQNA LVLLLGSGIP ANLPQGLGLD QTLLTEVPAG LPSDLLQRRP DILEAEHQLM       300
     AANASIGAAR AAFFPSISLT ANAGTMSRQL SGLFDAGSGS WLFQPSINLP IFTAGSLRAS       360
     LDYAKIQKDI NVAQYEKAIQ TAFQEVADGL AARGTFTEQL QAQRDLVKAS DEYYQLADKR       420
     YRTGVDNYLT LLDAQRSLFT AQQQLITDRL NQLTSEVNLY KALGGGWNQQ TVTQQQTAKK       480
     EDPQA                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page