(data stored in ACNUC7421 zone)

EMBL: CP000438.OSMC

CP000438.OSMC        Location/Qualifiers
FT   CDS             71112..71567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="PA14_00710"
FT                   /product="osmotically inducible protein OsmC"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15016"
FT                   /db_xref="GOA:A0A0H2ZJ00"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ00"
FT                   /protein_id="ABJ15016.1"
FT                   /translation="MSIHSSGGVDMKKTASAVWQGGLKDGKGTLSTESGALKDNPYGFN
FT                   TRFEGAPGTNPEELIGAAHAGCFSMALSMMLGEAGLTAERIETRAEVTLDKQSDGFAIT
FT                   AVHLVLRARVPGADAQTFEQIANKAKAGCPVSKVLNAKISLDASLDG"
     MSIHSSGGVD MKKTASAVWQ GGLKDGKGTL STESGALKDN PYGFNTRFEG APGTNPEELI        60
     GAAHAGCFSM ALSMMLGEAG LTAERIETRA EVTLDKQSDG FAITAVHLVL RARVPGADAQ       120
     TFEQIANKAK AGCPVSKVLN AKISLDASLD G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page