(data stored in ACNUC7421 zone)

EMBL: CP000438.OSTA

CP000438.OSTA        Location/Qualifiers
FT   CDS             complement(666574..669348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /gene_synonym="imp"
FT                   /locus_tag="PA14_07770"
FT                   /product="organic solvent tolerance protein OstA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_07770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15559"
FT                   /db_xref="GOA:Q02TG8"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02TG8"
FT                   /protein_id="ABJ15559.1"
FT                   /translation="MAVKSLVFRRKFPLLVTGSLLALQPVAALTVQAADQFDCKVSATG
FT                   GWDCSPLQNANANLPPRPAHTATSVSTAAAGSSVSGSGGETVEAEPTQRLVTESGGRAL
FT                   RSRSADYSHLDWIPREKLTAAQLAEIGPYCGGSYIEPVRPGMDDGAPSDESPTYVSAKA
FT                   SRYEQEKQIATLAGDVVLRQGSMQVEGDEANLHQLENRGELVGNVKLRDKGMLVVGDHA
FT                   QVQLDNGEAQVDNAEYVIHKAHARGSALYAKRSENAIIMLKDGTYTRCEPSSNAWTLKG
FT                   NNVKLNPATGFGTATNATLRVKDFPVFYTPYIYFPIDDRRQSGFLPPSFSSTSDTGFTL
FT                   VTPYYFNLAPNYDATLYPRYMAKRGMMLEGEFRYLTHSSEGIVNAAYLNDKDDHREGFP
FT                   DYSKDRWLYGLKNTTGLDSRWLAEVDYTRISDPYYFQDLDTDLGVGSTTYVNQRGTLTY
FT                   RGDTFTGRLNAQAYQLATTTDVTPYDRLPQITFDGFLPYNPGGMQFTYGTEFVRFDRDL
FT                   DENIYFNDDGSIRGKRPDASLQGLARATGDRMHLEPGMSLPMTRSWGYVTPTLKYLYTK
FT                   YDLDLDSQGKTDLNKRDESFDSNQDRSLPLVKVDSGLYFDRDTTFAGTPFRQTLEPRAM
FT                   YLYVPYKDQDSLPVFDTSEPSFSYDSLWRENRFTGKDRIGDANQLSLGVTSRFIEENGF
FT                   ERASISAGQIYYFRDRRVQLPGLTEKDLKRLNLDPSGLDNDSWRSPYAFAGQYRFNRDW
FT                   RINSDFNWNPNTSRTESGSAIFHYQPEVDPGKVVNVGYRYRADARRFDSSRGTFRYGNE
FT                   DDIIKQHDFSVIWPLVPQWSVLARWQYDYNKNRTLEAFGGFEYDSCCWKLRLINRYWLD
FT                   VDDDAFLVQSEKADRGIFLQIVLKGLGGIVGNKTEMFLDKGIQGYRQREDQAM"
     MAVKSLVFRR KFPLLVTGSL LALQPVAALT VQAADQFDCK VSATGGWDCS PLQNANANLP        60
     PRPAHTATSV STAAAGSSVS GSGGETVEAE PTQRLVTESG GRALRSRSAD YSHLDWIPRE       120
     KLTAAQLAEI GPYCGGSYIE PVRPGMDDGA PSDESPTYVS AKASRYEQEK QIATLAGDVV       180
     LRQGSMQVEG DEANLHQLEN RGELVGNVKL RDKGMLVVGD HAQVQLDNGE AQVDNAEYVI       240
     HKAHARGSAL YAKRSENAII MLKDGTYTRC EPSSNAWTLK GNNVKLNPAT GFGTATNATL       300
     RVKDFPVFYT PYIYFPIDDR RQSGFLPPSF SSTSDTGFTL VTPYYFNLAP NYDATLYPRY       360
     MAKRGMMLEG EFRYLTHSSE GIVNAAYLND KDDHREGFPD YSKDRWLYGL KNTTGLDSRW       420
     LAEVDYTRIS DPYYFQDLDT DLGVGSTTYV NQRGTLTYRG DTFTGRLNAQ AYQLATTTDV       480
     TPYDRLPQIT FDGFLPYNPG GMQFTYGTEF VRFDRDLDEN IYFNDDGSIR GKRPDASLQG       540
     LARATGDRMH LEPGMSLPMT RSWGYVTPTL KYLYTKYDLD LDSQGKTDLN KRDESFDSNQ       600
     DRSLPLVKVD SGLYFDRDTT FAGTPFRQTL EPRAMYLYVP YKDQDSLPVF DTSEPSFSYD       660
     SLWRENRFTG KDRIGDANQL SLGVTSRFIE ENGFERASIS AGQIYYFRDR RVQLPGLTEK       720
     DLKRLNLDPS GLDNDSWRSP YAFAGQYRFN RDWRINSDFN WNPNTSRTES GSAIFHYQPE       780
     VDPGKVVNVG YRYRADARRF DSSRGTFRYG NEDDIIKQHD FSVIWPLVPQ WSVLARWQYD       840
     YNKNRTLEAF GGFEYDSCCW KLRLINRYWL DVDDDAFLVQ SEKADRGIFL QIVLKGLGGI       900
     VGNKTEMFLD KGIQGYRQRE DQAM                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page