(data stored in ACNUC7421 zone)

EMBL: CP000438.PCAG

CP000438.PCAG        Location/Qualifiers
FT   CDS             174354..174959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaG"
FT                   /locus_tag="PA14_01910"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01910"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15111"
FT                   /db_xref="GOA:A0A0H2ZK90"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK90"
FT                   /protein_id="ABJ15111.1"
FT                   /translation="MSHELLRETPSQTAGPYVHIGLALAAAGNPTRDLEIWNRMAREGA
FT                   PGQHILLLGHVYDGNGHLVRDSFLEFWQADSEGRYQERYDPERPFNSFGRTATTFDAGE
FT                   WTLHTVKPGVVRNAQGVPMAPHINVSLFARGINIHLQTRLYFDDETEANAACPVLNLIE
FT                   QAPRRDTLLARRCEVDGQLAYRFDIRIQGDNETVFFDF"
     MSHELLRETP SQTAGPYVHI GLALAAAGNP TRDLEIWNRM AREGAPGQHI LLLGHVYDGN        60
     GHLVRDSFLE FWQADSEGRY QERYDPERPF NSFGRTATTF DAGEWTLHTV KPGVVRNAQG       120
     VPMAPHINVS LFARGINIHL QTRLYFDDET EANAACPVLN LIEQAPRRDT LLARRCEVDG       180
     QLAYRFDIRI QGDNETVFFD F                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page