(data stored in ACNUC7421 zone)

EMBL: CP000438.PCAH

CP000438.PCAH        Location/Qualifiers
FT   CDS             173624..174343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaH"
FT                   /locus_tag="PA14_01900"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01900"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15110"
FT                   /db_xref="GOA:A0A0H2ZJ87"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ87"
FT                   /protein_id="ABJ15110.1"
FT                   /translation="MHDAESRRFVIRDRNWHPKALTPDYKTSVPRSPSQALVSIPQSLS
FT                   ETSGPDFSHLRLGRHDNDLLLNFDHGGLPQGERIIMFGRVFDQYGKPVPHTLVEMWQAN
FT                   AGGRYRHKNDRYLAPLDPNFGGVGRTLTDSEGHYYFRTIKPGPYPWRNGPNDWRPAHIH
FT                   VSVSGPAIAARLVTQMYFEGDPLIPKCPIIRTLADPEAAQSLIGRLDMSMANPMDCLAY
FT                   RFDIVLRGQRKTFFENA"
     MHDAESRRFV IRDRNWHPKA LTPDYKTSVP RSPSQALVSI PQSLSETSGP DFSHLRLGRH        60
     DNDLLLNFDH GGLPQGERII MFGRVFDQYG KPVPHTLVEM WQANAGGRYR HKNDRYLAPL       120
     DPNFGGVGRT LTDSEGHYYF RTIKPGPYPW RNGPNDWRPA HIHVSVSGPA IAARLVTQMY       180
     FEGDPLIPKC PIIRTLADPE AAQSLIGRLD MSMANPMDCL AYRFDIVLRG QRKTFFENA        239
//

If you have problems or comments...

PBIL Back to PBIL home page