(data stored in ACNUC7421 zone)

EMBL: CP000438.PCAJ

CP000438.PCAJ        Location/Qualifiers
FT   CDS             246480..247262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcaJ"
FT                   /locus_tag="PA14_02770"
FT                   /product="putative CoA transferase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15176"
FT                   /db_xref="GOA:A0A0H2ZKN6"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKN6"
FT                   /protein_id="ABJ15176.1"
FT                   /translation="MSSYSTNEMMTVAAARRLHNGAVCFVGIGLPSKAANLARLTSSPD
FT                   VVLIYESGPIGAKPSVLPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAAQV
FT                   DRFGNINTTVIGDYRQPKVRLPGAGGAPEIAGSAKEVLIILKQSHRTFVDKLAFVTSVG
FT                   HGEGGDSRQRLGLPGKGPVAIITDLCIMEPEAGSNEFVVTSLHPGVTREQVVEATGWAI
FT                   RFAERVAETPAPSEVELAALRDLEARTAAAHGQKGSDE"
     MSSYSTNEMM TVAAARRLHN GAVCFVGIGL PSKAANLARL TSSPDVVLIY ESGPIGAKPS        60
     VLPLSIGDGE LAETADTVVP TGEIFRYWLQ GGRIDVGFLG AAQVDRFGNI NTTVIGDYRQ       120
     PKVRLPGAGG APEIAGSAKE VLIILKQSHR TFVDKLAFVT SVGHGEGGDS RQRLGLPGKG       180
     PVAIITDLCI MEPEAGSNEF VVTSLHPGVT REQVVEATGW AIRFAERVAE TPAPSEVELA       240
     ALRDLEARTA AAHGQKGSDE                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page