(data stored in ACNUC7421 zone)

EMBL: CP000438.PE100

CP000438.PE100       Location/Qualifiers
FT   CDS             115913..117112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01180"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15054"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA6"
FT                   /protein_id="ABJ15054.1"
FT                   /translation="MAPTSPAAPPGSTGSRAVRCRSTERGGPDMELLNATPLAAAYNQG
FT                   LDAEGRESLVVIAKGSFDLPLDGREARLLDEQQALLMVDEFYGEPGLSAPRRECEFVPF
FT                   KPFCDVLVLGSAQAPGGRPVQQLTAGIRVGRVSKALAVHGPRQWEPGLLGAGAGVAQPF
FT                   QRQDISYASAFGGSHASPDNPDFMDCYMANPAGCGWFPRSADTAEIVGTPMPATEKLGE
FT                   PVDSPHGRFTPMALGPLGRHWQARVGFAGRYDDAWLAERFPFLPADFDERYFQSAPADQ
FT                   WTDHLRGGEEVLLLNLTGEERAAFRVPRREVPVTFFLKKGGHETAQARIDTLLVDCDAR
FT                   RVEVTWRIRRPLKRNLFEIAQVLVGSKSAAWWRARELGKDYYPSLAALARSRQAEEDEA
FT                   "
     MAPTSPAAPP GSTGSRAVRC RSTERGGPDM ELLNATPLAA AYNQGLDAEG RESLVVIAKG        60
     SFDLPLDGRE ARLLDEQQAL LMVDEFYGEP GLSAPRRECE FVPFKPFCDV LVLGSAQAPG       120
     GRPVQQLTAG IRVGRVSKAL AVHGPRQWEP GLLGAGAGVA QPFQRQDISY ASAFGGSHAS       180
     PDNPDFMDCY MANPAGCGWF PRSADTAEIV GTPMPATEKL GEPVDSPHGR FTPMALGPLG       240
     RHWQARVGFA GRYDDAWLAE RFPFLPADFD ERYFQSAPAD QWTDHLRGGE EVLLLNLTGE       300
     ERAAFRVPRR EVPVTFFLKK GGHETAQARI DTLLVDCDAR RVEVTWRIRR PLKRNLFEIA       360
     QVLVGSKSAA WWRARELGKD YYPSLAALAR SRQAEEDEA                              399
//

If you have problems or comments...

PBIL Back to PBIL home page