(data stored in ACNUC7421 zone)

EMBL: CP000438.PE101

CP000438.PE101       Location/Qualifiers
FT   CDS             117109..118146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01190"
FT                   /product="Putative 3-oxoacyl-(acyl-carrier-protein)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01190"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15055"
FT                   /db_xref="GOA:A0A0H2ZJS8"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJS8"
FT                   /protein_id="ABJ15055.1"
FT                   /translation="MSQALSIVASGMVSAVGLSAPASCAAIRCALDNFQETRFIDQGGE
FT                   WLLAASVPLEQPWRGRAKLLKMAARAIDEALRGQPDLDCTELPLLLCVAEGDRPGRCAG
FT                   LDESFLRDLEGELGRRFHPSSALIARGRVGGAVALLNARKLIQGGCRQVLVAGVDSFVS
FT                   GPTLAAYEARERLLTSQNSNGFIPGEGAAAVLVAAPLHEEAPQLLCIGLGFGIEKATVE
FT                   SEDLPLRADGLTQAVRAALAEAGCGLEQMDYRLTDISGEQYYFKEASLTLSRNLRVLKP
FT                   KFDLWHPADCIGECGAAIGPALLAVALAASCKGYGDGPNVFCHLGNDAGERAAALLSYR
FT                   RVRAA"
     MSQALSIVAS GMVSAVGLSA PASCAAIRCA LDNFQETRFI DQGGEWLLAA SVPLEQPWRG        60
     RAKLLKMAAR AIDEALRGQP DLDCTELPLL LCVAEGDRPG RCAGLDESFL RDLEGELGRR       120
     FHPSSALIAR GRVGGAVALL NARKLIQGGC RQVLVAGVDS FVSGPTLAAY EARERLLTSQ       180
     NSNGFIPGEG AAAVLVAAPL HEEAPQLLCI GLGFGIEKAT VESEDLPLRA DGLTQAVRAA       240
     LAEAGCGLEQ MDYRLTDISG EQYYFKEASL TLSRNLRVLK PKFDLWHPAD CIGECGAAIG       300
     PALLAVALAA SCKGYGDGPN VFCHLGNDAG ERAAALLSYR RVRAA                       345
//

If you have problems or comments...

PBIL Back to PBIL home page