(data stored in ACNUC7421 zone)

EMBL: CP000438.PE102

CP000438.PE102       Location/Qualifiers
FT   CDS             118146..119237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01200"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15056"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="InterPro:IPR028917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ41"
FT                   /protein_id="ABJ15056.1"
FT                   /translation="MANEVYANNMEISCKAASGKSIAAFPDVCFTPPQAPPTPLGVPIP
FT                   YPNTGLSKDTTKGTRTIRITRKEVMLKNKSYYKTSYGDEPGRAPKKGIVTSKIKGKVYF
FT                   TSWSMNVKFESKNVVRHLDLTTHNHASFPGNTPPWIYSDKQTMALHKDCEEDVQKEKTA
FT                   CAGKKTKAEKCADDGCKKARKCLLVSYNQGKRKSGIGCCPGEQPHHLIEAHCFYEVGKR
FT                   GEGDSMFFNAPAGKQPYKDTESPCVCAEGPRHAGEHGQYHAFQQALEAKHHEKSGGWTY
FT                   ADARNAGVKANKAVNEQCNDKCTAAQLDSYHKERCGVTDSTPLRTDPQAGTRSVGTLDA
FT                   KQTAALQAEIGAMSGMSAAGGSL"
     MANEVYANNM EISCKAASGK SIAAFPDVCF TPPQAPPTPL GVPIPYPNTG LSKDTTKGTR        60
     TIRITRKEVM LKNKSYYKTS YGDEPGRAPK KGIVTSKIKG KVYFTSWSMN VKFESKNVVR       120
     HLDLTTHNHA SFPGNTPPWI YSDKQTMALH KDCEEDVQKE KTACAGKKTK AEKCADDGCK       180
     KARKCLLVSY NQGKRKSGIG CCPGEQPHHL IEAHCFYEVG KRGEGDSMFF NAPAGKQPYK       240
     DTESPCVCAE GPRHAGEHGQ YHAFQQALEA KHHEKSGGWT YADARNAGVK ANKAVNEQCN       300
     DKCTAAQLDS YHKERCGVTD STPLRTDPQA GTRSVGTLDA KQTAALQAEI GAMSGMSAAG       360
     GSL                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page