(data stored in ACNUC7421 zone)

EMBL: CP000438.PE103

CP000438.PE103       Location/Qualifiers
FT   CDS             119248..120168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01220"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK33"
FT                   /protein_id="ABJ15057.1"
FT                   /translation="MSFEKNHFSYLHGVVQSRTTIRAVAQIDQLTEQGAANATLIKWNL
FT                   SSPPPAAFNLAWYCTRMAIQKVPRGGGIELIYMGPDGHMGYGTANGDSEAPIWPAGEGP
FT                   DVYGVLRDLQGIGDGVYAVGMGRQVYRRDPSGAWQRKDAGTLQDRELMDVVGFNAIHGL
FT                   DEADLYAVGYAGEVWRCGNGRWEHLDSPTNVILNAVHMLPDRRVVVAGKNGFLMIGSAS
FT                   AWKVVETGLDAQIWDVQYFNDDIYLATSNALYRLDAHHVPQQVDMRLCGPVTCGQLHAG
FT                   DGILLSTGRKHQCWSDDGSVWHDLT"
     MSFEKNHFSY LHGVVQSRTT IRAVAQIDQL TEQGAANATL IKWNLSSPPP AAFNLAWYCT        60
     RMAIQKVPRG GGIELIYMGP DGHMGYGTAN GDSEAPIWPA GEGPDVYGVL RDLQGIGDGV       120
     YAVGMGRQVY RRDPSGAWQR KDAGTLQDRE LMDVVGFNAI HGLDEADLYA VGYAGEVWRC       180
     GNGRWEHLDS PTNVILNAVH MLPDRRVVVA GKNGFLMIGS ASAWKVVETG LDAQIWDVQY       240
     FNDDIYLATS NALYRLDAHH VPQQVDMRLC GPVTCGQLHA GDGILLSTGR KHQCWSDDGS       300
     VWHDLT                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page