(data stored in ACNUC7421 zone)

EMBL: CP000438.PE104

CP000438.PE104       Location/Qualifiers
FT   CDS             120178..121410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15058"
FT                   /db_xref="InterPro:IPR011959"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK43"
FT                   /protein_id="ABJ15058.1"
FT                   /translation="MLTSVVLDQHAEEAAFLALLRDYAVRAPHYDLEELAELDQRIEAH
FT                   LDGLAIAGQAGHDALLEQLDAHAQGEAFALAVLAMQAGDDALIGRMRACLAASPEARRG
FT                   FAAALGWLDWGQARPWVERLLASPEPLFRAIGLAACGMHRHDPGPALLSALGHADPAVL
FT                   ARAARTAGELRRRDLMANIRAYRAHDDPSLRFWANWATAQMGDEEALGPLRAFAGQPGP
FT                   FQLPATMVLLAWQPRDTSMAWIRQLMQAADTRRIGIQATGLFGDPVAVPWLIQQMRDES
FT                   LARVAGEAFSLITGADLALLDLELEALPDYDPGPNDDPDDDNVALDDDENLTWPEAERV
FT                   SAWWRDNGARFVAGRAYLLGEPLGEARCRQVLRNGQQRQRMAAACLLARFVPNLPLFPT
FT                   GAPVRRQLDLF"
     MLTSVVLDQH AEEAAFLALL RDYAVRAPHY DLEELAELDQ RIEAHLDGLA IAGQAGHDAL        60
     LEQLDAHAQG EAFALAVLAM QAGDDALIGR MRACLAASPE ARRGFAAALG WLDWGQARPW       120
     VERLLASPEP LFRAIGLAAC GMHRHDPGPA LLSALGHADP AVLARAARTA GELRRRDLMA       180
     NIRAYRAHDD PSLRFWANWA TAQMGDEEAL GPLRAFAGQP GPFQLPATMV LLAWQPRDTS       240
     MAWIRQLMQA ADTRRIGIQA TGLFGDPVAV PWLIQQMRDE SLARVAGEAF SLITGADLAL       300
     LDLELEALPD YDPGPNDDPD DDNVALDDDE NLTWPEAERV SAWWRDNGAR FVAGRAYLLG       360
     EPLGEARCRQ VLRNGQQRQR MAAACLLARF VPNLPLFPTG APVRRQLDLF                  410
//

If you have problems or comments...

PBIL Back to PBIL home page