(data stored in ACNUC7421 zone)

EMBL: CP000438.PE107

CP000438.PE107       Location/Qualifiers
FT   CDS             124433..125029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01270"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ46"
FT                   /protein_id="ABJ15061.1"
FT                   /translation="MVDGFVQPVGEGLADQLVGHQVGHGGVQWDQRLAEVGDVAVVHFF
FT                   HQAVRQVGLIEQGVEAVVAGEQRRRGEEELLGDLQHRLDPFLDAGFAGHAVGGVEQVRY
FT                   LFDVGVDEAGEYVFRVLALRLDGAMQAGQAAGYQISQVTVAGFAEVRLLDEFTEGSGVH
FT                   GFSHTTGMVKKRRNIAGGARRLRRDCHNRFVVMRG"
     MVDGFVQPVG EGLADQLVGH QVGHGGVQWD QRLAEVGDVA VVHFFHQAVR QVGLIEQGVE        60
     AVVAGEQRRR GEEELLGDLQ HRLDPFLDAG FAGHAVGGVE QVRYLFDVGV DEAGEYVFRV       120
     LALRLDGAMQ AGQAAGYQIS QVTVAGFAEV RLLDEFTEGS GVHGFSHTTG MVKKRRNIAG       180
     GARRLRRDCH NRFVVMRG                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page