(data stored in ACNUC7421 zone)

EMBL: CP000438.PE112

CP000438.PE112       Location/Qualifiers
FT   CDS             complement(129498..129707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15066"
FT                   /db_xref="GOA:A0A0H2ZJ51"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ51"
FT                   /protein_id="ABJ15066.1"
FT                   /translation="MLKVAIVLLLLATLVSLFSGLFFLVKDQGHGSRVVNSLTVRVVLA
FT                   AATLALVAWGFYSGELNSHAPWHF"
     MLKVAIVLLL LATLVSLFSG LFFLVKDQGH GSRVVNSLTV RVVLAAATLA LVAWGFYSGE        60
     LNSHAPWHF                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page