(data stored in ACNUC7421 zone)

EMBL: CP000438.PE113

CP000438.PE113       Location/Qualifiers
FT   CDS             129723..130517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15067"
FT                   /db_xref="GOA:A0A0H2ZK45"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK45"
FT                   /protein_id="ABJ15067.1"
FT                   /translation="MGGFMQYSQRLGEAGRNDRRSMRGAFRPGLLPTLVVLGLLPVLLW
FT                   LGTWQLQRADEKRALLASYEARRGAEPVSPGQLEGLRDPAYVRVRLHGRFDERHTLLLD
FT                   NRLRNGQAGVEVLQPFYDQASGLWLLVNRGWVAWTDRRSPPTLETPDRVLLLDAWTYLP
FT                   PPGGLHLADAPAGGWPRLVTQLDIPALWQAFGRAGLPWEIRLEPGDASFDTDWPLVSMP
FT                   PERHTGYAVQWFALATALLALYLYLGVRRAREKNHESRDSDA"
     MGGFMQYSQR LGEAGRNDRR SMRGAFRPGL LPTLVVLGLL PVLLWLGTWQ LQRADEKRAL        60
     LASYEARRGA EPVSPGQLEG LRDPAYVRVR LHGRFDERHT LLLDNRLRNG QAGVEVLQPF       120
     YDQASGLWLL VNRGWVAWTD RRSPPTLETP DRVLLLDAWT YLPPPGGLHL ADAPAGGWPR       180
     LVTQLDIPAL WQAFGRAGLP WEIRLEPGDA SFDTDWPLVS MPPERHTGYA VQWFALATAL       240
     LALYLYLGVR RAREKNHESR DSDA                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page