(data stored in ACNUC7421 zone)

EMBL: CP000438.PE114

CP000438.PE114       Location/Qualifiers
FT   CDS             130492..131070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01350"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15068"
FT                   /db_xref="GOA:A0A0H2ZK48"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK48"
FT                   /protein_id="ABJ15068.1"
FT                   /translation="MSLAIPMPERPRRARGRLQLLAIIGLVVGPMLLASAMYKWNFWVP
FT                   QGRSYSGALIGNGQTPADLGVQGRSQGEQWQLLVTAPGTCGEDCQQLVYLARQVNIALG
FT                   REASRAGHALAASGELPADFANLVRQDYPRLQRYGLDPALYDKAGGGERPLLWVVDPHG
FT                   NLVLRYDAKANGKKLLKDVQLLLKLSHIG"
     MSLAIPMPER PRRARGRLQL LAIIGLVVGP MLLASAMYKW NFWVPQGRSY SGALIGNGQT        60
     PADLGVQGRS QGEQWQLLVT APGTCGEDCQ QLVYLARQVN IALGREASRA GHALAASGEL       120
     PADFANLVRQ DYPRLQRYGL DPALYDKAGG GERPLLWVVD PHGNLVLRYD AKANGKKLLK       180
     DVQLLLKLSH IG                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page