(data stored in ACNUC7421 zone)

EMBL: CP000438.PE117

CP000438.PE117       Location/Qualifiers
FT   CDS             133174..133809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01390"
FT                   /product="putative Sco1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01390"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15071"
FT                   /db_xref="GOA:A0A0H2ZJU0"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJU0"
FT                   /protein_id="ABJ15071.1"
FT                   /translation="MTRVNKTVLVLVALVALVLGLTVHKVLTAQRQADPTVLLDAGIVI
FT                   LPQTRKVPALEFTNQDGQAVSTASLKGRWHLLFFGYTFCPDVCPTTLAQLRELQGKLPQ
FT                   EVRDDLQVVFVSVDPNRDTPQQIKQYLGYFNAGFQGLTGTPENIQKLANAMSIPYIPAD
FT                   TSKPNYTVDHSGNLVIIGPDGEQHGFIRAPLNNAKLEAQLPGVLKPQA"
     MTRVNKTVLV LVALVALVLG LTVHKVLTAQ RQADPTVLLD AGIVILPQTR KVPALEFTNQ        60
     DGQAVSTASL KGRWHLLFFG YTFCPDVCPT TLAQLRELQG KLPQEVRDDL QVVFVSVDPN       120
     RDTPQQIKQY LGYFNAGFQG LTGTPENIQK LANAMSIPYI PADTSKPNYT VDHSGNLVII       180
     GPDGEQHGFI RAPLNNAKLE AQLPGVLKPQ A                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page