(data stored in ACNUC7421 zone)

EMBL: CP000438.PE12

CP000438.PE12        Location/Qualifiers
FT   CDS             15208..15474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14968"
FT                   /db_xref="GOA:A0A0H2ZJX8"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX8"
FT                   /protein_id="ABJ14968.1"
FT                   /translation="MDNQRQYPRTPLKCRIRISHPLFGELMAQTRDLSDTGVYVKHPDL
FT                   TQLPTGSVVTGQVQDLPIDAPILQMEVVRVDAEGVGLRFLSEA"
     MDNQRQYPRT PLKCRIRISH PLFGELMAQT RDLSDTGVYV KHPDLTQLPT GSVVTGQVQD        60
     LPIDAPILQM EVVRVDAEGV GLRFLSEA                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page