(data stored in ACNUC7421 zone)

EMBL: CP000438.PE127

CP000438.PE127       Location/Qualifiers
FT   CDS             complement(141481..141762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01510"
FT                   /product="putative plasmid stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01510"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15081"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKD2"
FT                   /protein_id="ABJ15081.1"
FT                   /translation="MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQ
FT                   VANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKEIQILRIDRVEITP"
     MSLKWTRKAA ADLDAIYDHY VVLIGPEKAL KAVQDIVEQV KPLQQVANQG AGRPSEVPGV        60
     RTLTLERWPF SAPFRVKGKE IQILRIDRVE ITP                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page