(data stored in ACNUC7421 zone)

EMBL: CP000438.PE129

CP000438.PE129       Location/Qualifiers
FT   CDS             complement(142162..142785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ69"
FT                   /protein_id="ABJ15083.1"
FT                   /translation="MPTRVLRGLVAALPLLFLAACSDSAPSSEEIARLLAERGFDKPAC
FT                   ASSTLFKTFPVTLSDSFSGPGPAKGNAAVYDALVGVGLLRRDGDSYDLTPAGREDYKSE
FT                   SKAFCYSSGFDVSVRSVDPAKPDDYGPAVEKGWLVTVEVKPREVKDWAKNPEVLKQASL
FT                   TTLQQITQPQVGQVSLVKPRGEEGYKLVNTRFSPRQGFHFNQAW"
     MPTRVLRGLV AALPLLFLAA CSDSAPSSEE IARLLAERGF DKPACASSTL FKTFPVTLSD        60
     SFSGPGPAKG NAAVYDALVG VGLLRRDGDS YDLTPAGRED YKSESKAFCY SSGFDVSVRS       120
     VDPAKPDDYG PAVEKGWLVT VEVKPREVKD WAKNPEVLKQ ASLTTLQQIT QPQVGQVSLV       180
     KPRGEEGYKL VNTRFSPRQG FHFNQAW                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page