(data stored in ACNUC7421 zone)

EMBL: CP000438.PE13

CP000438.PE13        Location/Qualifiers
FT   CDS             15621..16274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00140"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14969"
FT                   /db_xref="GOA:A0A0H2ZK11"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK11"
FT                   /protein_id="ABJ14969.1"
FT                   /translation="MSASSPAAWRGTLAGLIAFHIVIIIASNYLVQLPITLFGWHTTWG
FT                   AFSFPFIFLATDLTVRLLGKGPARLVIARVMIPALIASYVVSVLFQEAAFRGFSALLEF
FT                   NTFVARISLASFLAYVLGQILDIQVFDRLRRSRHWWTAPVASTILGNLLDTFTFFFVAF
FT                   WRSDNPFMAQHWVEIATVDYGVKLSISLLLFVPLYGMLLNGILKMLPGRPQSNA"
     MSASSPAAWR GTLAGLIAFH IVIIIASNYL VQLPITLFGW HTTWGAFSFP FIFLATDLTV        60
     RLLGKGPARL VIARVMIPAL IASYVVSVLF QEAAFRGFSA LLEFNTFVAR ISLASFLAYV       120
     LGQILDIQVF DRLRRSRHWW TAPVASTILG NLLDTFTFFF VAFWRSDNPF MAQHWVEIAT       180
     VDYGVKLSIS LLLFVPLYGM LLNGILKMLP GRPQSNA                                217
//

If you have problems or comments...

PBIL Back to PBIL home page