(data stored in ACNUC7421 zone)

EMBL: CP000438.PE134

CP000438.PE134       Location/Qualifiers
FT   CDS             complement(147054..147341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15088"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJ72"
FT                   /protein_id="ABJ15088.1"
FT                   /translation="MSGRPQAVPTVQVDNAEVIVTEWRFAPGAETGRHRHGHDYVVVPL
FT                   TDGTLLLETPEGDRHAPLVAGQAYFRKAGVEHNVINASAHEVVFVETEIK"
     MSGRPQAVPT VQVDNAEVIV TEWRFAPGAE TGRHRHGHDY VVVPLTDGTL LLETPEGDRH        60
     APLVAGQAYF RKAGVEHNVI NASAHEVVFV ETEIK                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page