(data stored in ACNUC7421 zone)

EMBL: CP000438.PE143

CP000438.PE143       Location/Qualifiers
FT   CDS             complement(158517..159413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01730"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15097"
FT                   /db_xref="GOA:A0A0H2ZKF2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKF2"
FT                   /protein_id="ABJ15097.1"
FT                   /translation="MALQVASAPHGSSEDSTSASLPANYPYHTRMRRNEYEKAKHDLQI
FT                   ELLKVQSWVKETGQRVVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQEQGQ
FT                   WYFQRYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERMLSNSG
FT                   ILLFKYWFSVSREEQLRRFISRRDDPLKHWKLSPIDIKSLDKWDDYTAAKQAMFFHTDT
FT                   ADAPWTVIKSDDKKRARLNCIRHFLHALDYPDKDRRIAHEPDPLLVGPASRVIEEDEKV
FT                   YAEAAAAPGHANLDIPA"
     MALQVASAPH GSSEDSTSAS LPANYPYHTR MRRNEYEKAK HDLQIELLKV QSWVKETGQR        60
     VVVLFEGRDA AGKGGTIKRF MEHLNPRGAR IVALEKPSSQ EQGQWYFQRY IQHLPTAGEM       120
     VFFDRSWYNR AGVERVMGFC SPLQYLEFMR QAPELERMLS NSGILLFKYW FSVSREEQLR       180
     RFISRRDDPL KHWKLSPIDI KSLDKWDDYT AAKQAMFFHT DTADAPWTVI KSDDKKRARL       240
     NCIRHFLHAL DYPDKDRRIA HEPDPLLVGP ASRVIEEDEK VYAEAAAAPG HANLDIPA         298
//

If you have problems or comments...

PBIL Back to PBIL home page