(data stored in ACNUC7421 zone)

EMBL: CP000438.PE146

CP000438.PE146       Location/Qualifiers
FT   CDS             complement(162413..163261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01770"
FT                   /product="putative nucleoside-binding outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01770"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15100"
FT                   /db_xref="GOA:A0A0H2ZK78"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK78"
FT                   /protein_id="ABJ15100.1"
FT                   /translation="MRKALLCCAAPLCAAAAFGAENNDENAAREGLWNNLHVYRAFNQR
FT                   GGPYLTDDSYLEWEFGGRKGVLDLYGYIDYKNLFDDASSDVPDGENWFVDIEPRLSIDR
FT                   LLGRDFSIGPIREWFVAFDYYYADARQGPGLNVLWSGIGTNTELPWLGTVGLNLYARYI
FT                   DKNYGASNENAWDGYVAHMNWFKPLAQFGGKRFIAFQGFFDYEFGSKLPDKDDAFEREY
FT                   RTDNGFQAYLGLWYHTEHWKFGYGAKVYRNMTQWRDGEQLDGRRTDSSGIGHYFNVGYA
FT                   F"
     MRKALLCCAA PLCAAAAFGA ENNDENAARE GLWNNLHVYR AFNQRGGPYL TDDSYLEWEF        60
     GGRKGVLDLY GYIDYKNLFD DASSDVPDGE NWFVDIEPRL SIDRLLGRDF SIGPIREWFV       120
     AFDYYYADAR QGPGLNVLWS GIGTNTELPW LGTVGLNLYA RYIDKNYGAS NENAWDGYVA       180
     HMNWFKPLAQ FGGKRFIAFQ GFFDYEFGSK LPDKDDAFER EYRTDNGFQA YLGLWYHTEH       240
     WKFGYGAKVY RNMTQWRDGE QLDGRRTDSS GIGHYFNVGY AF                          282
//

If you have problems or comments...

PBIL Back to PBIL home page