(data stored in ACNUC7421 zone)

EMBL: CP000438.PE149

CP000438.PE149       Location/Qualifiers
FT   CDS             164828..165925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01800"
FT                   /product="putative basic membrane protein (bmp)"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15103"
FT                   /db_xref="GOA:A0A0H2ZJW7"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJW7"
FT                   /protein_id="ABJ15103.1"
FT                   /translation="MKHRPTQSRMSVLRRLAVVLGLGACALAAEAAEPLKIGFVYVGPV
FT                   GDHGWTYQHELGRRELVEHFGDKVKTSFVENVAEGADAERVIRNLAKDGYGLVFTTSFG
FT                   YMNPTAKVARQFPKVTFEHATGYKRDRNLGTYLSRSYEGRYVGGFLAAKMTRSHKIGYI
FT                   ASFPIPEVIRDINAIQLALDKYDPQAELKVMWVSTWFDPGKEADAANALIDQGVDVVFQ
FT                   HTDSPAPIQAAERRGVYAVGYASDMQHFGPKTVLTSIVNDWGPHYIRSAQAVMDGTWKS
FT                   EDFWGGLAESTVVLPLNQEVLPAPVREEAGRLIESIRSGAFHPFTGPIRDQSGKERFAA
FT                   GVSATNADLASMNYYVEGIKADLPK"
     MKHRPTQSRM SVLRRLAVVL GLGACALAAE AAEPLKIGFV YVGPVGDHGW TYQHELGRRE        60
     LVEHFGDKVK TSFVENVAEG ADAERVIRNL AKDGYGLVFT TSFGYMNPTA KVARQFPKVT       120
     FEHATGYKRD RNLGTYLSRS YEGRYVGGFL AAKMTRSHKI GYIASFPIPE VIRDINAIQL       180
     ALDKYDPQAE LKVMWVSTWF DPGKEADAAN ALIDQGVDVV FQHTDSPAPI QAAERRGVYA       240
     VGYASDMQHF GPKTVLTSIV NDWGPHYIRS AQAVMDGTWK SEDFWGGLAE STVVLPLNQE       300
     VLPAPVREEA GRLIESIRSG AFHPFTGPIR DQSGKERFAA GVSATNADLA SMNYYVEGIK       360
     ADLPK                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page