(data stored in ACNUC7421 zone)

EMBL: CP000438.PE15

CP000438.PE15        Location/Qualifiers
FT   CDS             complement(16923..17240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_00160"
FT                   /product="putative tetratricopeptide repeat domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ14971"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZIW8"
FT                   /protein_id="ABJ14971.1"
FT                   /translation="MMIEGLEKMLAKGVDNALLRFGLGKGYLDAGDAERATEHLQRCVE
FT                   QDPTYSAGWKLLGKARQAAGDLAGARQAWEQGLAAAATHGDKQAEKEMTVFLRKLDRAR
FT                   T"
     MMIEGLEKML AKGVDNALLR FGLGKGYLDA GDAERATEHL QRCVEQDPTY SAGWKLLGKA        60
     RQAAGDLAGA RQAWEQGLAA AATHGDKQAE KEMTVFLRKL DRART                       105
//

If you have problems or comments...

PBIL Back to PBIL home page