(data stored in ACNUC7421 zone)

EMBL: CP000438.PE154

CP000438.PE154       Location/Qualifiers
FT   CDS             169897..172284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01870"
FT                   /product="putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01870"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15108"
FT                   /db_xref="GOA:A0A0H2ZKG6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKG6"
FT                   /protein_id="ABJ15108.1"
FT                   /translation="MTPFPRFALRTLPALFLSLGCLAATAQAAEAVRYRFSQAAAPLAQ
FT                   ALNAFSRASGQTLLYTAELPPQATAPALHGSLDAEEALQRLLQGSGLRARRIDERTLTL
FT                   EPIPASGALDLDATTVSAAAPAQGYRPAANASISRGDAPLLEIPQAISVVPAQALQDQR
FT                   PRNLDDALGNISGITQANTLGGTQDAVMKRGFGDNRDGSIMRDGMPSVQGRNFTATADH
FT                   VEVLKGPASLLYGIQDPGGVVNVVSKKPQLQQANALTLRGSAYAHGRNGSGGQLDSTGP
FT                   LGDSGLAYRMILDHEDEDYWRDFGKSRETLVTPSLAWYGEDTTVNLSYEHREFTTPFDR
FT                   GTAIDPRTNRPLDIPRSRRLDEPFNITEGRSELTRLDLERQLDDTWKAHFGYGYSRETY
FT                   DDNQARVMAVNADGTLTRRMDGTHGAVSSDSFATLGLSGTLQLAGMQHDLQFGMDHEKR
FT                   KIFRADLLRDSKTSRFDYLDPVYGQVVPSTRVVAGDSDQTDKLRSDSLYFQDSIHLDER
FT                   WILVGGARYQIYDQLAGRGRPFNANTDINGQKWVPRGGLVYRLSDEVSLYGSYTRSFKP
FT                   NSTIAPLSTGETIDSAILPEEATSWELGAKLDVPGRLSGTLALFDIRKKNVLVNELDGA
FT                   GNSSVRAAGRVRSRGLELDLTGQLSERWSLIGSYAWLAAEVTEDPTLEGKRLQNVARNT
FT                   ASLSAVYELGQLFGGDRLRLGGGARYVGKRPGDPANSFDLPSYTVADAFASYDTRFGGH
FT                   GVKFQLNVKNLFDRTYYPSSANRLYVAMGEPRQFQLSTTVEF"
     MTPFPRFALR TLPALFLSLG CLAATAQAAE AVRYRFSQAA APLAQALNAF SRASGQTLLY        60
     TAELPPQATA PALHGSLDAE EALQRLLQGS GLRARRIDER TLTLEPIPAS GALDLDATTV       120
     SAAAPAQGYR PAANASISRG DAPLLEIPQA ISVVPAQALQ DQRPRNLDDA LGNISGITQA       180
     NTLGGTQDAV MKRGFGDNRD GSIMRDGMPS VQGRNFTATA DHVEVLKGPA SLLYGIQDPG       240
     GVVNVVSKKP QLQQANALTL RGSAYAHGRN GSGGQLDSTG PLGDSGLAYR MILDHEDEDY       300
     WRDFGKSRET LVTPSLAWYG EDTTVNLSYE HREFTTPFDR GTAIDPRTNR PLDIPRSRRL       360
     DEPFNITEGR SELTRLDLER QLDDTWKAHF GYGYSRETYD DNQARVMAVN ADGTLTRRMD       420
     GTHGAVSSDS FATLGLSGTL QLAGMQHDLQ FGMDHEKRKI FRADLLRDSK TSRFDYLDPV       480
     YGQVVPSTRV VAGDSDQTDK LRSDSLYFQD SIHLDERWIL VGGARYQIYD QLAGRGRPFN       540
     ANTDINGQKW VPRGGLVYRL SDEVSLYGSY TRSFKPNSTI APLSTGETID SAILPEEATS       600
     WELGAKLDVP GRLSGTLALF DIRKKNVLVN ELDGAGNSSV RAAGRVRSRG LELDLTGQLS       660
     ERWSLIGSYA WLAAEVTEDP TLEGKRLQNV ARNTASLSAV YELGQLFGGD RLRLGGGARY       720
     VGKRPGDPAN SFDLPSYTVA DAFASYDTRF GGHGVKFQLN VKNLFDRTYY PSSANRLYVA       780
     MGEPRQFQLS TTVEF                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page