(data stored in ACNUC7421 zone)

EMBL: CP000438.PE159

CP000438.PE159       Location/Qualifiers
FT   CDS             176167..177318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01940"
FT                   /product="putative RND efflux membrane fusion protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15113"
FT                   /db_xref="GOA:A0A0H2ZKH1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKH1"
FT                   /protein_id="ABJ15113.1"
FT                   /translation="MSDARGAFHSKGRWSRMALPAILCASLLVGCGAEPPAEEHVRVLA
FT                   QTVKMAEFASATSITGDIQARVQADQSFRVGGKIVERLVDVGDHVAAGQVLARLDPQDQ
FT                   RSNVENAQAAVAAQQAQSKLADLNYQRQKALLPKGYTSQSEYDQALASVRSAQSSLKAA
FT                   QAQLANARDLLSYTELRASDAGVITARQAEVGQVVQATVPIFTLARDGERDAVFNVYES
FT                   LFSHDVDGQRITVSLLGKPEVTASGKVREITPTVDERSGTLKVKVGLDSVPAEMSLGSV
FT                   VNASVAAPAAHSVVLPWSALSKVGEQPAVWLLDQESKVRLQPVRVARYASEKVVIDGGL
FT                   EAGQTVVTVGGQLLHPGQVVEVAQPPQPTQSTASRDAVGGGQP"
     MSDARGAFHS KGRWSRMALP AILCASLLVG CGAEPPAEEH VRVLAQTVKM AEFASATSIT        60
     GDIQARVQAD QSFRVGGKIV ERLVDVGDHV AAGQVLARLD PQDQRSNVEN AQAAVAAQQA       120
     QSKLADLNYQ RQKALLPKGY TSQSEYDQAL ASVRSAQSSL KAAQAQLANA RDLLSYTELR       180
     ASDAGVITAR QAEVGQVVQA TVPIFTLARD GERDAVFNVY ESLFSHDVDG QRITVSLLGK       240
     PEVTASGKVR EITPTVDERS GTLKVKVGLD SVPAEMSLGS VVNASVAAPA AHSVVLPWSA       300
     LSKVGEQPAV WLLDQESKVR LQPVRVARYA SEKVVIDGGL EAGQTVVTVG GQLLHPGQVV       360
     EVAQPPQPTQ STASRDAVGG GQP                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page