(data stored in ACNUC7421 zone)

EMBL: CP000438.PE160

CP000438.PE160       Location/Qualifiers
FT   CDS             177315..178385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_01960"
FT                   /product="putative RND efflux membrane fusion protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_01960"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15114"
FT                   /db_xref="GOA:A0A0H2ZJX6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJX6"
FT                   /protein_id="ABJ15114.1"
FT                   /translation="MKPFSLAGLFGFALLLSGCGDEPPPAPPRPVLTVTVKTLKNDDLG
FT                   RFAGSIQARYESVLGFRTNGRIASRLFDVGDFVGKGALLATLDPTDQQNQLRASQGDLA
FT                   SAEAQLIDAQANARRQEELFARSVTAQARLDDARTRLKTSQASFDQAKAAVQQARDQLS
FT                   YTRLVTDFDGVITTWHAEAGQVVSAGQAVVTLARPEVREAVFDLPTEVAESLPADARFL
FT                   VSAQLDPQARTTGSIRELGPQADASTRTRRVRLSLAQTPEAFRLGSTIQVQLSSAGSVR
FT                   SVLPASVLLERDGKTQVWVVDGKQSSVALREVQVLSRDERQVVIGQGLADGDRVVRAGV
FT                   NSLKPGQKIKLDEDAR"
     MKPFSLAGLF GFALLLSGCG DEPPPAPPRP VLTVTVKTLK NDDLGRFAGS IQARYESVLG        60
     FRTNGRIASR LFDVGDFVGK GALLATLDPT DQQNQLRASQ GDLASAEAQL IDAQANARRQ       120
     EELFARSVTA QARLDDARTR LKTSQASFDQ AKAAVQQARD QLSYTRLVTD FDGVITTWHA       180
     EAGQVVSAGQ AVVTLARPEV REAVFDLPTE VAESLPADAR FLVSAQLDPQ ARTTGSIREL       240
     GPQADASTRT RRVRLSLAQT PEAFRLGSTI QVQLSSAGSV RSVLPASVLL ERDGKTQVWV       300
     VDGKQSSVAL REVQVLSRDE RQVVIGQGLA DGDRVVRAGV NSLKPGQKIK LDEDAR           356
//

If you have problems or comments...

PBIL Back to PBIL home page