(data stored in ACNUC7421 zone)

EMBL: CP000438.PE168

CP000438.PE168       Location/Qualifiers
FT   CDS             187980..188816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02060"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15122"
FT                   /db_xref="GOA:A0A0H2ZK89"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK89"
FT                   /protein_id="ABJ15122.1"
FT                   /translation="MSRTLATVMLAGGLLAAGQAVAEDHDMTPTHETDSGPLLWHNESL
FT                   TYLYGKNFKINPPIQQTFTLEHASGWTWGDLFIFFDQINYNGKEDASNGKNTYYGEITP
FT                   RLSFGKLTGADLSFGPVKDVLLAGTYEFGEGDTEAYLLGPGFDLAIPGFDYFQLNFYYR
FT                   KPDGNRVRAGAWQITPVWSYTIPVGNSDILIDGYMDWVINNKSASTSRRNQSDYHANLH
FT                   FNPQVKYDLGKALGYEPKHLYVGLEYDYWSDKYGVKDSQYFTTDQNTASFLVKYHF"
     MSRTLATVML AGGLLAAGQA VAEDHDMTPT HETDSGPLLW HNESLTYLYG KNFKINPPIQ        60
     QTFTLEHASG WTWGDLFIFF DQINYNGKED ASNGKNTYYG EITPRLSFGK LTGADLSFGP       120
     VKDVLLAGTY EFGEGDTEAY LLGPGFDLAI PGFDYFQLNF YYRKPDGNRV RAGAWQITPV       180
     WSYTIPVGNS DILIDGYMDW VINNKSASTS RRNQSDYHAN LHFNPQVKYD LGKALGYEPK       240
     HLYVGLEYDY WSDKYGVKDS QYFTTDQNTA SFLVKYHF                               278
//

If you have problems or comments...

PBIL Back to PBIL home page