(data stored in ACNUC7421 zone)

EMBL: CP000438.PE171

CP000438.PE171       Location/Qualifiers
FT   CDS             191228..191818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02100"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15125"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZJA5"
FT                   /protein_id="ABJ15125.1"
FT                   /translation="MPSTLQGLAEYREEIRKSRFHTIAAPVADEDEAQAFIAAHRDASA
FT                   GHNCWAWKCGAQYRFSDDGEPGGSAGRPILAAIEGQDMDCVVVLVSRWFGGIKLGTGGL
FT                   ARAYGGGAAKCLQQAPRSELVERCRVRFACAFADHALLKARSLALGASVAAEDYGADGV
FT                   VLTLELPVARFEALQALLVDLSRGQVRPQRLDA"
     MPSTLQGLAE YREEIRKSRF HTIAAPVADE DEAQAFIAAH RDASAGHNCW AWKCGAQYRF        60
     SDDGEPGGSA GRPILAAIEG QDMDCVVVLV SRWFGGIKLG TGGLARAYGG GAAKCLQQAP       120
     RSELVERCRV RFACAFADHA LLKARSLALG ASVAAEDYGA DGVVLTLELP VARFEALQAL       180
     LVDLSRGQVR PQRLDA                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page