(data stored in ACNUC7421 zone)

EMBL: CP000438.PE172

CP000438.PE172       Location/Qualifiers
FT   CDS             complement(191825..192532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02110"
FT                   /product="putative GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02110"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15126"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKA5"
FT                   /protein_id="ABJ15126.1"
FT                   /translation="MRLERIARISDGFQSMAREQNLSLSERYHKQLRRLEKVARISDRY
FT                   QQMMRDLNLALKEASIRDPLTGLPNRRMLLERLREENERSQRHGQSYVLAMLDVDFFKQ
FT                   VNDTWGHDSGDRVLVEIARAMESELREYDLCGRWGGEEFLLLLPQTRLQDAGPVLERVR
FT                   DSVRTLAVRVGTEALSVTASVGVTEHRIGETYSQTVNRADAALLDAKRSGRDKCVFAAL
FT                   PPLPAPSRPAPAR"
     MRLERIARIS DGFQSMAREQ NLSLSERYHK QLRRLEKVAR ISDRYQQMMR DLNLALKEAS        60
     IRDPLTGLPN RRMLLERLRE ENERSQRHGQ SYVLAMLDVD FFKQVNDTWG HDSGDRVLVE       120
     IARAMESELR EYDLCGRWGG EEFLLLLPQT RLQDAGPVLE RVRDSVRTLA VRVGTEALSV       180
     TASVGVTEHR IGETYSQTVN RADAALLDAK RSGRDKCVFA ALPPLPAPSR PAPAR            235
//

If you have problems or comments...

PBIL Back to PBIL home page