(data stored in ACNUC7421 zone)

EMBL: CP000438.PE173

CP000438.PE173       Location/Qualifiers
FT   CDS             complement(192659..193039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02130"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15127"
FT                   /db_xref="InterPro:IPR018530"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02UQ8"
FT                   /protein_id="ABJ15127.1"
FT                   /translation="MSDLHIPGTQSTPAIQGDWQAGRLSMQGDSYPENSYELFGQVIDW
FT                   VERFLADGQRPLELDLRLLYLNTSSIKAMMDILDLLEEAHQGGRPVSLRWHYDRRNERV
FT                   AELAEEFREDCSFPFAIQAHDE"
     MSDLHIPGTQ STPAIQGDWQ AGRLSMQGDS YPENSYELFG QVIDWVERFL ADGQRPLELD        60
     LRLLYLNTSS IKAMMDILDL LEEAHQGGRP VSLRWHYDRR NERVAELAEE FREDCSFPFA       120
     IQAHDE                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page