(data stored in ACNUC7421 zone)

EMBL: CP000438.PE174

CP000438.PE174       Location/Qualifiers
FT   CDS             complement(193066..193608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15128"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZK93"
FT                   /protein_id="ABJ15128.1"
FT                   /translation="METLDLLAMRESYTRQRILLCFNGPISRSLIEEIGHALRNYLHAE
FT                   QAKPSEAMDVFAVYIEMTQNIRHYANLKGYGEHEAAATVAIARNEDGHYVVSAGNLVER
FT                   DDGQSLVRSIQAIANLDKAALKAAYKEQLRRPRDSGCASGAGLGLLDIARKSSEPLAAS
FT                   LKEQPDGRAFFSLRAVI"
     METLDLLAMR ESYTRQRILL CFNGPISRSL IEEIGHALRN YLHAEQAKPS EAMDVFAVYI        60
     EMTQNIRHYA NLKGYGEHEA AATVAIARNE DGHYVVSAGN LVERDDGQSL VRSIQAIANL       120
     DKAALKAAYK EQLRRPRDSG CASGAGLGLL DIARKSSEPL AASLKEQPDG RAFFSLRAVI       180
//

If you have problems or comments...

PBIL Back to PBIL home page