(data stored in ACNUC7421 zone)

EMBL: CP000438.PE193

CP000438.PE193       Location/Qualifiers
FT   CDS             215908..218280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PA14_02410"
FT                   /product="putative TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PA14_02410"
FT                   /db_xref="EnsemblGenomes-Tr:ABJ15147"
FT                   /db_xref="GOA:A0A0H2ZKC8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2ZKC8"
FT                   /protein_id="ABJ15147.1"
FT                   /translation="MKYHYRLPLRRTPPGGSDYALALLLALGGALPASAADAPAPAEEA
FT                   PPLAGSAPAKADTALGKVTVTARRREEDSQKVPTPITVLGGETLEAQRISRVQDLQQVL
FT                   PSVNVAYIHARQSSVAVRGIGNNPASDGLEGSAGIYLDNVYLGRPGMAVFDLLDIEQLE
FT                   LLRGPQGTLFGKNTTAGVLNISTRAPTFTTERTVEVSGGQDGYFQGRGTVSGPLGETLA
FT                   GRLSAYRTRDDGYIKNIHDDNYLNGGERQGARGQLLFEPNEDFSLRWIADYNEEDSSNG
FT                   SMVVYGAAERFWQRAALVGASPLRDPQRKKVNINGRQHVSVHQGGSSLEANWNLAGGYR
FT                   LTSISAYRYWHFTPANDEQLNVSAINDTGVEVHDRQFSQEIRLASPTGGAFDYVVGAYA
FT                   FRQNLGNKTFTSYGPLADLYLLGANLGALNDTYSKANGKIETDSFALFAQGTWHLSERL
FT                   DFTAGLRGTYEEKNAKVERFAPLGGAAVGGVGAAVRNGQLGAYDSGDLSQYNFAPSALL
FT                   SLSYQFSDDLLGYASLSHGEKSGGVNLAVGSAPSAGADSLLVGPERANDAELGLKSTLF
FT                   DRRLLLNANLFWTGIHGYQATTLYQAPGSTQLVQVLANAGSVRSRGLEFEATALPLRGL
FT                   TLNFNGSYNDVTYLSFKDAPCPAEVSTRPGAPSSCDLSGQRVVGASKWIANLNGEYQWR
FT                   LDDRFQPYVSASYAYRSAAEGTLDNSDLSKIDGYALVNLAAGLRSDLGDGQLDTSVWLK
FT                   NAFDKDYYLSAFASINGSYTASVGQPRTLGVSLRYDF"
     MKYHYRLPLR RTPPGGSDYA LALLLALGGA LPASAADAPA PAEEAPPLAG SAPAKADTAL        60
     GKVTVTARRR EEDSQKVPTP ITVLGGETLE AQRISRVQDL QQVLPSVNVA YIHARQSSVA       120
     VRGIGNNPAS DGLEGSAGIY LDNVYLGRPG MAVFDLLDIE QLELLRGPQG TLFGKNTTAG       180
     VLNISTRAPT FTTERTVEVS GGQDGYFQGR GTVSGPLGET LAGRLSAYRT RDDGYIKNIH       240
     DDNYLNGGER QGARGQLLFE PNEDFSLRWI ADYNEEDSSN GSMVVYGAAE RFWQRAALVG       300
     ASPLRDPQRK KVNINGRQHV SVHQGGSSLE ANWNLAGGYR LTSISAYRYW HFTPANDEQL       360
     NVSAINDTGV EVHDRQFSQE IRLASPTGGA FDYVVGAYAF RQNLGNKTFT SYGPLADLYL       420
     LGANLGALND TYSKANGKIE TDSFALFAQG TWHLSERLDF TAGLRGTYEE KNAKVERFAP       480
     LGGAAVGGVG AAVRNGQLGA YDSGDLSQYN FAPSALLSLS YQFSDDLLGY ASLSHGEKSG       540
     GVNLAVGSAP SAGADSLLVG PERANDAELG LKSTLFDRRL LLNANLFWTG IHGYQATTLY       600
     QAPGSTQLVQ VLANAGSVRS RGLEFEATAL PLRGLTLNFN GSYNDVTYLS FKDAPCPAEV       660
     STRPGAPSSC DLSGQRVVGA SKWIANLNGE YQWRLDDRFQ PYVSASYAYR SAAEGTLDNS       720
     DLSKIDGYAL VNLAAGLRSD LGDGQLDTSV WLKNAFDKDY YLSAFASING SYTASVGQPR       780
     TLGVSLRYDF                                                              790
//

If you have problems or comments...

PBIL Back to PBIL home page